RPS6KA4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10130P
Artikelname: RPS6KA4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10130P
Hersteller Artikelnummer: CNA10130P
Alternativnummer: MBL-CNA10130P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 673-772 of human RPS6KA4 (NP_003933.1).
Konjugation: Unconjugated
Alternative Synonym: MSK2, RSK-B, S6K-alpha-4
Klonalität: Polyclonal
Molekulargewicht: 86kDa
NCBI: 8986
UniProt: O75676
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: WLQDGSARSSPPLRTPDVLESSGPAVRSGLNATFMAFNRGKREGFFLKSVENAPLAKRRKQKLRSATASRRGSPAPANPGRAPVASKGAPRRANGPLPPS
Target-Kategorie: RPS6KA4
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:20 - 1:100