LILRB2/CD85d/ILT4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10135S
Artikelname: LILRB2/CD85d/ILT4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10135S
Hersteller Artikelnummer: CNA10135S
Alternativnummer: MBL-CNA10135S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 22-240 of human LILRB2/CD85d/ILT4 (Q8N423).
Konjugation: Unconjugated
Alternative Synonym: ILT4, LIR2, CD85D, ILT-4, LIR-2, MIR10, MIR-10
Klonalität: Polyclonal
Molekulargewicht: 65kDa
NCBI: 10288
UniProt: Q8N423
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: QTGTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEEEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPGVSKKPSLSVQPGPVVAPGES
Target-Kategorie: LILRB2
Application Verdünnung: WB: WB,1:1000 - 1:4000