TXNL4A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10138S
Artikelname: TXNL4A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10138S
Hersteller Artikelnummer: CNA10138S
Alternativnummer: MBL-CNA10138S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-142 of human TXNL4A (NP_006692.1).
Konjugation: Unconjugated
Alternative Synonym: BMKS, DIB1, DIM1, TXNL4, SNRNP15, U5-15kD
Klonalität: Polyclonal
Molekulargewicht: 17kDa
NCBI: 10907
UniProt: P83876
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY
Target-Kategorie: TXNL4A
Application Verdünnung: WB: WB,1:500 - 1:2000