HLA-C Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1013S
Artikelname: HLA-C Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1013S
Hersteller Artikelnummer: CNA1013S
Alternativnummer: MBL-CNA1013S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 25-308 of human HLA-C (P30499).
Konjugation: Unconjugated
Alternative Synonym: MHC, HLAC, HLC-C, D6S204, PSORS1, HLA-JY3
Klonalität: Polyclonal
Molekulargewicht: 41kDa
NCBI: 3107
UniProt: P10321
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: CSHSMKYFFTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYNRQAQTDRVSLRNLRGYYNQSEAGSHTLQWMCGCDLGPDGRLLRGYDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEERRAYLEGTCVEWLRRYLENGKESLQRAEHPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQWDGEDQTQDTELVETRPAGDGTFQKWAAVMVPSGEE
Target-Kategorie: HLA-C
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200