IL17RB Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
MBL-CNA10147S
| Artikelname: |
IL17RB Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: |
MBL-CNA10147S |
| Hersteller Artikelnummer: |
CNA10147S |
| Alternativnummer: |
MBL-CNA10147S |
| Hersteller: |
MBL |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human, Mouse, Rat |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 18-292 of human IL17RB (NP_061195.2). |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
CRL4, EVI27, IL17BR, IL17RH1 |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
56kDa |
| NCBI: |
55540 |
| UniProt: |
Q9NRM6 |
| Puffer: |
PBS with 0.02% sodium azide,50% glycerol |
| Quelle: |
Rabbit |
| Reinheit: |
Affinity purification |
| Formulierung: |
PBS with 0.02% sodium azide,50% glycerol |
| Sequenz: |
REPTVQCGSETGPSPEWMLQHDLIPGDLRDLRVEPVTTSVATGDYSILMNVSWVLRADASIRLLKATKICVTGKSNFQSYSCVRCNYTEAFQTQTRPSGGKWTFSYIGFPVELNTVYFIGAHNIPNANMNEDGPSMSVNFTSPGCLDHIMKYKKKCVKAGSLWDPNITACKKNEETVEVNFTTTPLGNRYMALIQHSTIIGFSQVFEPHQKKQTRASVVIPVTGDSEGATVQLTPYFPTCGSDCIRHKGTVVLC |
| Target-Kategorie: |
IL17RB |
| Application Verdünnung: |
WB: WB,1:1000 - 1:4000 |
