KLHL9 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10149S
Artikelname: KLHL9 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10149S
Hersteller Artikelnummer: CNA10149S
Alternativnummer: MBL-CNA10149S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human KLHL9 (NP_061335.1).
Konjugation: Unconjugated
Alternative Synonym: KLHL9
Klonalität: Polyclonal
Molekulargewicht: 69kDa
NCBI: 55958
UniProt: Q9P2J3
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MKVSLGNGEMGVSAHLQPCKAGTTRFFTSNTHSSVVLQGFDQLRIEGLLCDVTLVPGDGDEIFPVHRAMMASASDYFKAMFTGGMKEQDLMCIKLHGVNK
Target-Kategorie: KLHL9
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200