CRLF2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10152S
Artikelname: CRLF2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10152S
Hersteller Artikelnummer: CNA10152S
Alternativnummer: MBL-CNA10152S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 23-231 of human CRLF2 (NP_071431.2).
Konjugation: Unconjugated
Alternative Synonym: CRL2, TSLPR, CRLF2Y
Klonalität: Polyclonal
Molekulargewicht: 42kDa
NCBI: 64109
UniProt: Q9HC73
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: QGGAAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHYRFNGDEAYDQCTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPSSPKHVRFSWHQDAVTVTCSDLSYGDLLYEVQYRSPFDTEWQSKQENTCNVTIEGLDAEKCYSFWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSK
Target-Kategorie: CRLF2
Application Verdünnung: WB: WB,1:200 - 1:1000