GRHL2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10153S
Artikelname: GRHL2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10153S
Hersteller Artikelnummer: CNA10153S
Alternativnummer: MBL-CNA10153S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 80-250 of human GRHL2 (NP_079191.2).
Konjugation: Unconjugated
Alternative Synonym: BOM, ECTDS, PPCD4, DFNA28, TFCP2L3
Klonalität: Polyclonal
Molekulargewicht: 71kDa
NCBI: 79977
UniProt: Q6ISB3
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: LSVSKASDSQEDQEKRNCLGTSEAQSNLSGGENRVQVLKTVPVNLSLNQDHLENSKREQYSISFPESSAIIPVSGITVVKAEDFTPVFMAPPVHYPRGDGEEQRVVIFEQTQYDVPSLATHSAYLKDDQRSTPDSTYSESFKDAATEKFRSASVGAEEYMYDQTSSGTFQY
Target-Kategorie: GRHL2
Application Verdünnung: WB: WB,1:500 - 1:1000