SMUG1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10166S
Artikelname: SMUG1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10166S
Hersteller Artikelnummer: CNA10166S
Alternativnummer: MBL-CNA10166S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human SMUG1 (NP_055126.1).
Konjugation: Unconjugated
Alternative Synonym: FDG, UNG3, HMUDG
Klonalität: Polyclonal
Molekulargewicht: 30kDa
NCBI: 23583
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MPQAFLLGSIHEPAGALMEPQPCPGSLAESFLEEELRLNAELSQLQFSEPVGIIYNPVEYAWEPHRNYVTRYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVSMVRDWLGIVGPVLTPPQEHPKRPVLGLECPQSEVSGARFWGFFRNLCGQPEVFFHHCFVHNLCPLLFLAPSGRNLTPAELPAKQREQLLGICDAALCRQVQLLGVRLVVGVGRLAEQRARRALAGLMPEVQVEGLLHPSPRNPQANKGWEAV
Target-Kategorie: SMUG1
Application Verdünnung: WB: WB,1:200 - 1:1000