PDX1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10173S
Artikelname: PDX1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10173S
Hersteller Artikelnummer: CNA10173S
Alternativnummer: MBL-CNA10173S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PDX1 (NP_000200.1).
Konjugation: Unconjugated
Alternative Synonym: GSF, IPF1, IUF1, IDX-1, MODY4, PDX-1, STF-1, PAGEN1
Klonalität: Polyclonal
Molekulargewicht: 31kDa
NCBI: 3651
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MNGEEQYYAATQLYKDPCAFQRGPAPEFSASPPACLYMGRQPPPPPPHPFPGALGALEQGSPPDISPYEVPPLADDPAVAHLHHHLPAQLALPHPPAGPF
Target-Kategorie: PDX1
Application Verdünnung: WB: WB,1:500 - 1:1000