IARS Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10190S
Artikelname: IARS Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10190S
Hersteller Artikelnummer: CNA10190S
Alternativnummer: MBL-CNA10190S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1158-1262 of human IARS (NP_002152.2).
Konjugation: Unconjugated
Alternative Synonym: IRS, IARS, ILRS, ILERS, GRIDHH, PRO0785
Klonalität: Polyclonal
Molekulargewicht: 144kDa
NCBI: 3376
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: SAPSLINSSSTLLCQYINLQLLNAKPQECLMGTVGTLLLENPLGQNGLTHQGLLYEAAKVFGLRSRKLKLFLNETQTQEITEDIPVKTLNMKTVYVSVLPTTADF
Target-Kategorie: IARS1
Application Verdünnung: WB: WB,1:500 - 1:2000