KIF4A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10193S
Artikelname: KIF4A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10193S
Hersteller Artikelnummer: CNA10193S
Alternativnummer: MBL-CNA10193S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 870-1080 of human KIF4A (NP_036442.3).
Konjugation: Unconjugated
Alternative Synonym: KIF4, KIF4G1, MRX100, XLID100
Klonalität: Polyclonal
Molekulargewicht: 140kDa
NCBI: 24137
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: LIGELVSSKIQVSKLESSLKQSKTSCADMQKMLFEERNHFAEIETELQAELVRMEQQHQEKVLYLLSQLQQSQMAEKQLEESVSEKEQQLLSTLKCQDEELEKMREVCEQNQQLLRENEIIKQKLTLLQVASRQKHLPKDTLLSPDSSFEYVPPKPKPSRVKEKFLEQSMDIEDLKYCSEHSVNEHEDGDGDDDEGDDEEWKPTKLVKVSR
Target-Kategorie: KIF4A
Application Verdünnung: WB: WB,1:1000 - 1:3000|IHC-P,1:50 - 1:200|IF/ICC,1:100 - 1:200