ZSCAN4C Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10205S
Artikelname: ZSCAN4C Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10205S
Hersteller Artikelnummer: CNA10205S
Alternativnummer: MBL-CNA10205S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 400-506 of mouse ZSCAN4 (NP_001013787.1).
Konjugation: Unconjugated
Alternative Synonym: Gm397, Zscan4d, XM_142517
Klonalität: Polyclonal
Molekulargewicht: 57kDa
NCBI: 245109
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: CSRMFKHARSLSSHQRTHLNKKSELLCVTCQKMFKRVSDRRTHEIIHMPEKPFKCSTCEKSFSHKTNLKSHEMIHTGEMPYVCSLCSRRFRQSSTYHRHLRNYHRSD
Target-Kategorie: Zscan4c
Application Verdünnung: WB: WB,1:500 - 1:2000