CLDN5 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10207P
Artikelname: CLDN5 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10207P
Hersteller Artikelnummer: CNA10207P
Alternativnummer: MBL-CNA10207P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 119-218 of human CLDN5 (NP_001349995.1).
Konjugation: Unconjugated
Alternative Synonym: AWAL, BEC1, TMVCF, TMDVCF, CPETRL1
Klonalität: Polyclonal
Molekulargewicht: 23kDa
NCBI: 7122
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: LTGGVLYLFCGLLALVPLCWFANIVVREFYDPSVPVSQKYELGAALYIGWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKNYV
Target-Kategorie: CLDN5
Application Verdünnung: WB: WB,1:1000 - 1:5000|IF/ICC,1:50 - 1:200