DIAPH2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10209S
Artikelname: DIAPH2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10209S
Hersteller Artikelnummer: CNA10209S
Alternativnummer: MBL-CNA10209S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human DIAPH2 (NP_009293.1).
Konjugation: Unconjugated
Alternative Synonym: DIA, POF, DIA2, DRF2, POF2, POF2A
Klonalität: Polyclonal
Molekulargewicht: 126kDa
NCBI: 1730
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MEQPGAAASGAGGGSEEPGGGRSNKRSAGNRAANEEETKNKPKLNIQIKTLADDVRDRITSFRKSTVKKEKPLIQHPIDSQVAMSEFPAAQPLYDERSLNLSEKEVLDLFEKMMEDMNLN
Target-Kategorie: DIAPH2
Application Verdünnung: WB: WB,1:1000 - 1:2000