Aurora B Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1020T
Artikelname: Aurora B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1020T
Hersteller Artikelnummer: CNA1020T
Alternativnummer: MBL-CNA1020T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Aurora B (NP_004208.2).
Konjugation: Unconjugated
Alternative Synonym: AIK2, AIM1, ARK2, AurB, IPL1, STK5, AIM-1, ARK-2, STK-1, STK12, PPP1R48, aurkb-sv1, aurkb-sv2
Klonalität: Polyclonal
Molekulargewicht: 39kDa
NCBI: 9212
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMENSSGTPDILTRHFTIDDFEIGRPLGKGKFGNVYLAREKKSH
Target-Kategorie: AURKB
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200