GPER1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10217T
Artikelname: GPER1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10217T
Hersteller Artikelnummer: CNA10217T
Alternativnummer: MBL-CNA10217T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 307-375 of human GPER1 (Q99527).
Konjugation: Unconjugated
Alternative Synonym: mER, CEPR, GPER, DRY12, FEG-1, GPR30, LERGU, LyGPR, CMKRL2, LERGU2, GPCR-Br
Klonalität: Polyclonal
Molekulargewicht: 42kDa
NCBI: 2852
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: HIVNLAAFSNSCLNPLIYSFLGETFRDKLRLYIEQKTNLPALNRFCHAALKAVIPDSTEQSDVRFSSAV
Target-Kategorie: GPER1
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200