GYG1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10218S
Artikelname: GYG1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10218S
Hersteller Artikelnummer: CNA10218S
Alternativnummer: MBL-CNA10218S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 234-333 of human GYG1 (NP_001171649.1).
Konjugation: Unconjugated
Alternative Synonym: GYG, GSD15
Klonalität: Polyclonal
Molekulargewicht: 39kDa
NCBI: 2992
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: EAHDPNMTHPEFLILWWNIFTTNVLPLLQQFGLVKDTCSYVNVEDVSGAISHLSLGEIPAMAQPFVSSEERKERWEQGQADYMGADSFDNIKRKLDTYLQ
Target-Kategorie: GYG1
Application Verdünnung: WB: WB,1:200 - 1:2000