LY6E Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10225S
Artikelname: LY6E Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10225S
Hersteller Artikelnummer: CNA10225S
Alternativnummer: MBL-CNA10225S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 21-101 of human LY6E (NP_002337.1).
Konjugation: Unconjugated
Alternative Synonym: RIGE, SCA2, RIG-E, SCA-2, TSA-1
Klonalität: Polyclonal
Molekulargewicht: 14kDa
NCBI: 4061
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFS
Target-Kategorie: LY6E
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200