DMT1/SLC11A2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10231P
Artikelname: DMT1/SLC11A2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10231P
Hersteller Artikelnummer: CNA10231P
Alternativnummer: MBL-CNA10231P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-63 of human DMT1/SLC11A2 (NP_001167597.1).
Konjugation: Unconjugated
Alternative Synonym: DCT1, DMT1, AHMIO1, NRAMP2
Klonalität: Polyclonal
Molekulargewicht: 62kDa
NCBI: 4891
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYS
Target-Kategorie: SLC11A2
Application Verdünnung: WB: WB,1:1000 - 1:2000|IHC-P,1:50 - 1:200