PCDH1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10234S
Artikelname: PCDH1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10234S
Hersteller Artikelnummer: CNA10234S
Alternativnummer: MBL-CNA10234S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 60-220 of human PCDH1 (NP_002578.2).
Konjugation: Unconjugated
Alternative Synonym: PC42, PCDH42
Klonalität: Polyclonal
Molekulargewicht: 115kDa
NCBI: 5097
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: VVYKVPEEQPPNTLIGSLAADYGFPDVGHLYKLEVGAPYLRVDGKTGDIFTTETSIDREGLRECQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQ
Target-Kategorie: PCDH1
Application Verdünnung: WB: WB,1:1000 - 1:2000