Septin 4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10238S
Artikelname: Septin 4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10238S
Hersteller Artikelnummer: CNA10238S
Alternativnummer: MBL-CNA10238S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Septin 4 (NP_536341.1).
Konjugation: Unconjugated
Alternative Synonym: H5, ARTS, MART, SEP4, CE5B3, SEPT4, PNUTL2, hucep-7, BRADEION, C17orf47, hCDCREL-2
Klonalität: Polyclonal
Molekulargewicht: 55kDa
NCBI: 5414
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MIKRFLEDTTDDGELSKFVKDFSGNASCHPPEAKTWASRPQVPEPRPQAPDLYDDDLEFRPPSRPQSSDNQQYFCAPAPLSPSARPRSPWGKLDPYDSSE
Target-Kategorie: SEPTIN4
Application Verdünnung: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200