SLC25A1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10247S
Artikelname: SLC25A1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10247S
Hersteller Artikelnummer: CNA10247S
Alternativnummer: MBL-CNA10247S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-311 of human SLC25A1 (NP_005975.1).
Konjugation: Unconjugated
Alternative Synonym: CIC, CTP, SEA, CMS23, D2L2AD, SLC20A3
Klonalität: Polyclonal
Molekulargewicht: 34kDa
NCBI: 6576
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MPAPRAPRALAAAAPASGKAKLTHPGKAILAGGLAGGIEICITFPTEYVKTQLQLDERSHPPRYRGIGDCVRQTVRSHGVLGLYRGLSSLLYGSIPKAAVRFGMFEFLSNHMRDAQGRLDSTRGLLCGLGAGVAEAVVVVCPMETIKVKFIHDQTSPNPKYRGFFHGVREIVREQGLKGTYQGLTATVLKQGSNQAIRFFVMTSLRNWYRGDNPNKPMNPLITGVFGAIAGAASVFGNTPLDVIKTRMQGLEAH
Target-Kategorie: SLC25A1
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200