TPD52 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10254S
Artikelname: TPD52 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10254S
Hersteller Artikelnummer: CNA10254S
Alternativnummer: MBL-CNA10254S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-184 of human TPD52 (NP_005070.1).
Konjugation: Unconjugated
Alternative Synonym: D52, N8L, PC-1, PrLZ, hD52
Klonalität: Polyclonal
Molekulargewicht: 24kDa
NCBI: 7163
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MDRGEQGLLRTDPVPEEGEDVAATISATETLSEEEQEELRRELAKVEEEIQTLSQVLAAKEKHLAEIKRKLGINSLQELKQNIAKGWQDVTATSAYKKTSETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL
Target-Kategorie: TPD52
Application Verdünnung: WB: WB,1:1000 - 1:2000|IHC-P,1:50 - 1:200