XPNPEP2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10255S
Artikelname: XPNPEP2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10255S
Hersteller Artikelnummer: CNA10255S
Alternativnummer: MBL-CNA10255S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 22-240 of human XPNPEP2 (NP_003390.4).
Konjugation: Unconjugated
Alternative Synonym: APP2, AEACEI
Klonalität: Polyclonal
Molekulargewicht: 76kDa
NCBI: 7512
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: HTKPVDLGGQDVRNCSTNPPYLPVTVVNTTMSLTALRQQMQTQNLSAYIIPGTDAHMNEYIGQHDERRAWITGFTGSAGTAVVTMKKAAVWTDSRYWTQAERQMDCNWELHKEVGTTPIVTWLLTEIPAGGRVGFDPFLLSIDTWESYDLALQGSNRQLVSITTNLVDLVWGSERPPVPNQPIYALQEAFTGSTWQEKVSGVRSQMQKHQKVPTAVLLS
Target-Kategorie: XPNPEP2
Application Verdünnung: WB: WB,1:1000 - 1:2000