eIF3B Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10259S
Artikelname: eIF3B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10259S
Hersteller Artikelnummer: CNA10259S
Alternativnummer: MBL-CNA10259S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 100-350 of human eIF3B (NP_003742.2).
Konjugation: Unconjugated
Alternative Synonym: PRT1, EIF3S9, EIF3-ETA, EIF3-P110, EIF3-P116
Klonalität: Polyclonal
Molekulargewicht: 93kDa
NCBI: 8662
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: PVPAQGEAPGEQARDERSDSRAQAVSEDAGGNEGRAAEAEPRALENGDADEPSFSDPEDFVDDVSEEELLGDVLKDRPQEADGIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITNDFYPEEDGKTKGYIFLEYASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPFKDLGNLRYWLEEAECRDQYSVIFESGDRTSIFWNDVKDPVSIEERARWTETYVRWSPKGTYLA
Target-Kategorie: EIF3B
Application Verdünnung: WB: WB,1:1000 - 1:2000|IF/ICC,1:50 - 1:200