USP13 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
MBL-CNA10264S
| Artikelname: |
USP13 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: |
MBL-CNA10264S |
| Hersteller Artikelnummer: |
CNA10264S |
| Alternativnummer: |
MBL-CNA10264S |
| Hersteller: |
MBL |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Mouse, Rat |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 90-200 of human USP13 (NP_003931.2). |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
ISOT3, IsoT-3 |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
97kDa |
| NCBI: |
8975 |
| Puffer: |
PBS with 0.02% sodium azide,50% glycerol |
| Quelle: |
Rabbit |
| Reinheit: |
Affinity purification |
| Formulierung: |
PBS with 0.02% sodium azide,50% glycerol |
| Sequenz: |
MHLKRHVREKVRGASGGALPKRRNSKIFLDLDTDDDLNSDDYEYEDEAKLVIFPDHYEIALPNIEELPALVTIACDAVLSSKSPYRKQDPDTWENELPVSKYANNLTQLDN |
| Target-Kategorie: |
USP13 |
| Application Verdünnung: |
WB: WB,1:1000 - 1:2000 |
