CACNA2D2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10267S
Artikelname: CACNA2D2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10267S
Hersteller Artikelnummer: CNA10267S
Alternativnummer: MBL-CNA10267S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 20-200 of human CACNA2D2 (NP_001167522.1).
Konjugation: Unconjugated
Alternative Synonym: CASVDD, CACNA2D
Klonalität: Polyclonal
Molekulargewicht: 130kDa
NCBI: 9254
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: RPWPGCGPHPGPGTRRPTSGPPRPLWLLLPLLPLLAAPGASAYSFPQQHTMQHWARRLEQEVDGVMRIFGGVQQLREIYKDNRNLFEVQENEPQKLVEKVAGDIESLLDRKVQALKRLADAAENFQKAHRWQDNIKEEDIVYYDAKADAELDDPESEDVERGSKASTLRLDFIEDPNFKNK
Target-Kategorie: CACNA2D2
Application Verdünnung: WB: WB,1:200 - 1:2000