NRXN3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10269S
Artikelname: NRXN3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10269S
Hersteller Artikelnummer: CNA10269S
Alternativnummer: MBL-CNA10269S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 373-432 of human NRXN3 (NP_620426.2).
Konjugation: Unconjugated
Alternative Synonym: C14orf60
Klonalität: Polyclonal
Molekulargewicht: 43kDa/47kDa/50kDa/69kDa/117kDa/153kDa/180kDa
NCBI: 9369
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: ILLYAMYKYRNRDEGSYQVDETRNYISNSAQSNGTLMKEKQQSSKSGHKKQKNKDREYYV
Target-Kategorie: NRXN3
Application Verdünnung: WB: WB,1:1000 - 1:2000