14-3-3 sigma Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1026T
Artikelname: 14-3-3 sigma Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1026T
Hersteller Artikelnummer: CNA1026T
Alternativnummer: MBL-CNA1026T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human 14-3-3 sigma (NP_006133.1).
Konjugation: Unconjugated
Alternative Synonym: YWHAS
Klonalität: Polyclonal
Molekulargewicht: 28kDa
NCBI: 2810
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVL
Target-Kategorie: SFN
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200