KCNMB2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10277S
Artikelname: KCNMB2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10277S
Hersteller Artikelnummer: CNA10277S
Alternativnummer: MBL-CNA10277S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 68-194 of human KCNMB2 (NP_005823.1).
Konjugation: Unconjugated
Alternative Synonym: KCNMB2
Klonalität: Polyclonal
Molekulargewicht: 27kDa
NCBI: 10242
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: TLLRSYMQSVWTEESQCTLLNASITETFNCSFSCGPDCWKLSQYPCLQVYVNLTSSGEKLLLYHTEETIKINQKCSYIPKCGKNFEESMSLVNVVMENFRKYQHFSCYSDPEGNQKSVILTKLYSSN
Target-Kategorie: KCNMB2
Application Verdünnung: WB: WB,1:500 - 1:2000