POMT1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10281S
Artikelname: POMT1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10281S
Hersteller Artikelnummer: CNA10281S
Alternativnummer: MBL-CNA10281S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 310-550 of human POMT1 (NP_001070833.1).
Konjugation: Unconjugated
Alternative Synonym: RT, LGMD2K, MDDGA1, MDDGB1, MDDGC1, LGMDR11
Klonalität: Polyclonal
Molekulargewicht: 85kDa
NCBI: 10585
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: VFGKPVPCWLHSHQDTYPMIYENGRGSSHQQQVTCYPFKDVNNWWIVKDPRRHQLVVSSPPRPVRHGDMVQLVHGMTTRSLNTHDVAAPLSPHSQEVSCYIDYNISMPAQNLWRLEIVNRGSDTDVWKTILSEVRFVHVNTSAVLKLSGAHLPDWGYRQLEIVGEKLSRGYHGSTVWNVEEHRYGASQEQRERERELHSPAQVDVSRNLSFMARFSELQWRMLALRSDDSEHKYSSSPLEW
Target-Kategorie: POMT1
Application Verdünnung: WB: WB,1:1000 - 1:2000