DUSP14 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10287S
Artikelname: DUSP14 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10287S
Hersteller Artikelnummer: CNA10287S
Alternativnummer: MBL-CNA10287S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-198 of human DUSP14 (NP_008957.1).
Konjugation: Unconjugated
Alternative Synonym: MKP6, MKP-L
Klonalität: Polyclonal
Molekulargewicht: 22kDa
NCBI: 11072
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRHLMPYWGI
Target-Kategorie: DUSP14
Application Verdünnung: WB: WB,1:200 - 1:2000|IF/ICC,1:50 - 1:200