EMC1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10290S
Artikelname: EMC1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10290S
Hersteller Artikelnummer: CNA10290S
Alternativnummer: MBL-CNA10290S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 885-965 of human EMC1 (NP_055862.1).
Konjugation: Unconjugated
Alternative Synonym: CAVIPMR, KIAA0090
Klonalität: Polyclonal
Molekulargewicht: 112kDa
NCBI: 23065
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: IPTEQSREENLIPYSPDVQIHAERFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDYVLI
Target-Kategorie: EMC1
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200