ICMT Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10293S
Artikelname: ICMT Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10293S
Hersteller Artikelnummer: CNA10293S
Alternativnummer: MBL-CNA10293S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 175-284 of human ICMT (NP_036537.1).
Konjugation: Unconjugated
Alternative Synonym: PCMT, PPMT, PCCMT, HSTE14, MST098, MSTP098
Klonalität: Polyclonal
Molekulargewicht: 32kDa
NCBI: 23463
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: KAAMFTAGSNFNHVVQNEKSDTHTLVTSGVYAWFRHPSYVGWFYWSIGTQVMLCNPICGVSYALTVWRFFRDRTEEEEISLIHFFGEEYLEYKKRVPTGLPFIKGVKVDL
Target-Kategorie: ICMT
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200