SNAPIN Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10294S
Artikelname: SNAPIN Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10294S
Hersteller Artikelnummer: CNA10294S
Alternativnummer: MBL-CNA10294S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-136 of human SNAPIN (NP_036569.1).
Konjugation: Unconjugated
Alternative Synonym: BLOS7, BORCS3, SNAPAP, BLOC1S7
Klonalität: Polyclonal
Molekulargewicht: 15kDa
NCBI: 23557
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MAGAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYPPGSPGK
Target-Kategorie: SNAPIN
Application Verdünnung: WB: WB,1:200 - 1:2000|IHC-P,1:50 - 1:200