INVS Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10298S
Artikelname: INVS Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10298S
Hersteller Artikelnummer: CNA10298S
Alternativnummer: MBL-CNA10298S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human INVS (NP_055240.2).
Konjugation: Unconjugated
Alternative Synonym: INV, NPH2, NPHP2
Klonalität: Polyclonal
Molekulargewicht: 118kDa
NCBI: 27130
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MNKSENLLFAGSSLASQVHAAAVNGDKGALQRLIVGNSALKDKEDQFGRTPLMYCVLADRLDCADALLKAGADVNKTDHSQRTALHLAAQ
Target-Kategorie: INVS
Application Verdünnung: WB: WB,1:500 - 1:2000