OTUB1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10313S
Artikelname: OTUB1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10313S
Hersteller Artikelnummer: CNA10313S
Alternativnummer: MBL-CNA10313S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human OTUB1 (NP_060140.2).
Konjugation: Unconjugated
Alternative Synonym: OTB1, OTU1, HSPC263
Klonalität: Polyclonal
Molekulargewicht: 31kDa
NCBI: 55611
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: ERLELSVLYKEYAEDDNIYQQKIKDLHKKYSYIRKTRPDGNCFYRAFGFSHLEALLDDSKELQRFKAVSAKSKEDLVSQGFTEFTIEDFHNTFMDLIEQVE
Target-Kategorie: OTUB1
Application Verdünnung: WB: WB,1:500 - 1:2000