CACNA2D3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10315S
Artikelname: CACNA2D3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10315S
Hersteller Artikelnummer: CNA10315S
Alternativnummer: MBL-CNA10315S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 900-1040 of human CACNA2D3 (NP_060868.2).
Konjugation: Unconjugated
Alternative Synonym: HSA272268
Klonalität: Polyclonal
Molekulargewicht: 123kDa
NCBI: 55799
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: LYDYQAMCRANKESSDGAHGLLDPYNAFLSAVKWIMTELVLFLVEFNLCSWWHSDMTAKAQKLKQTLEPCDTEYPAFVSERTIKETTGNIACEDCSKSFVIQQIPSSNLFMVVVDSSCLCESVAPITMAPIEIRYNESLKC
Target-Kategorie: CACNA2D3
Application Verdünnung: WB: WB,1:1000 - 1:2000