LRRC4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10321S
Artikelname: LRRC4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10321S
Hersteller Artikelnummer: CNA10321S
Alternativnummer: MBL-CNA10321S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 544-653 of human LRRC4 (NP_071426.1).
Konjugation: Unconjugated
Alternative Synonym: NAG14, NGL-2
Klonalität: Polyclonal
Molekulargewicht: 73kDa
NCBI: 64101
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: LIVFYKLRKRHQQRSTVTAARTVEIIQVDEDIPAATSAAATAAPSGVSGEGAVVLPTIHDHINYNTYKPAHGAHWTENSLGNSLHPTVTTISEPYIIQTHTKDKVQETQI
Target-Kategorie: LRRC4
Application Verdünnung: WB: WB,1:1000 - 1:2000