FCRL4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10329S
Artikelname: FCRL4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10329S
Hersteller Artikelnummer: CNA10329S
Alternativnummer: MBL-CNA10329S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 120-387 of human FCRL4 (NP_112572.1).
Konjugation: Unconjugated
Alternative Synonym: FCRH4, IGFP2, IRTA1, CD307d
Klonalität: Polyclonal
Molekulargewicht: 57kDa
NCBI: 83417
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: VLRCHRRRKEKLTAVKYTWNGNILSISNKSWDLLIPQASSNNNGNYRCIGYGDENDVFRSNFKIIKIQELFPHPELKATDSQPTEGNSVNLSCETQLPPERSDTPLHFNFFRDGEVILSDWSTYPELQLPTVWRENSGSYWCGAETVRGNIHKHSPSLQIHVQRIPVSGVLLETQPSGGQAVEGEMLVLVCSVAEGTGDTTFSWHREDMQESLGRKTQRSLRAELELPAIRQSHAGGYYCTADNSYGPVQSMVL
Target-Kategorie: FCRL4
Application Verdünnung: WB: WB,1:500 - 1:2000