RAB34 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10332S
Artikelname: RAB34 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10332S
Hersteller Artikelnummer: CNA10332S
Alternativnummer: MBL-CNA10332S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-259 of human RAB34 (NP_114140.4).
Konjugation: Unconjugated
Alternative Synonym: RAH, NARR, RAB39
Klonalität: Polyclonal
Molekulargewicht: 21kDa/28kDa/29kDa
NCBI: 83871
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MNILAPVRRDRVLAELPQCLRKEAALHGHKDFHPRVTCACQEHRTGTVGFKISKVIVVGDLSVGKTCLINRFCKDTFDKNYKATIGVDFEMERFEVLGIPFSLQLWDTAGQERFKCIASTYYRGAQAIIIVFNLNDVASLEHTKQWLADALKENDPSSVLLFLVGSKKDLSTPAQYALMEKDALQVAQEMKAEYWAVSSLTGENVREFFFRVAALTFEANVLAELEKSGARRIGDVVRINSDDSNLYLTASKKK
Target-Kategorie: RAB34
Application Verdünnung: WB: WB,1:500 - 1:2000