STRIP1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10334S
Artikelname: STRIP1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10334S
Hersteller Artikelnummer: CNA10334S
Alternativnummer: MBL-CNA10334S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 743-837 of human STRIP1 (NP_149079.2).
Konjugation: Unconjugated
Alternative Synonym: FAM40A, FAR11A
Klonalität: Polyclonal
Molekulargewicht: 96kDa
NCBI: 85369
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: VRHRLNDDWAYGNDLDARPWDFQAEECALRANIERFNARRYDRAHSNPDFLPVDNCLQSVLGQRVDLPEDFQMNYDLWLEREVFSKPISWEELLQ
Target-Kategorie: STRIP1
Application Verdünnung: WB: WB,1:1000 - 1:2000|IF/ICC,1:50 - 1:200