KIAA0101 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10357T
Artikelname: KIAA0101 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10357T
Hersteller Artikelnummer: CNA10357T
Alternativnummer: MBL-CNA10357T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 39-111 of human KIAA0101 (NP_055551.1).
Konjugation: Unconjugated
Alternative Synonym: L5, PAF, OEATC, PAF15, OEATC1, p15PAF, NS5ATP9, OEATC-1, p15/PAF, KIAA0101, p15(PAF)
Klonalität: Polyclonal
Molekulargewicht: 12kDa
NCBI: 9768
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: SSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE
Target-Kategorie: PCLAF
Application Verdünnung: WB: WB,1:500 - 1:2000