HNRPLL Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10360S
Artikelname: HNRPLL Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10360S
Hersteller Artikelnummer: CNA10360S
Alternativnummer: MBL-CNA10360S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 250-350 of human HNRPLL (NP_612403.2).
Konjugation: Unconjugated
Alternative Synonym: SRRF, HNRPLL
Klonalität: Polyclonal
Molekulargewicht: 60kDa
NCBI: 92906
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: IRNDNDSWDYTKPYLGRRDRGKGRQRQAILGEHPSSFRHDGYGSHGPLLPLPSRYRMGSRDTPELVAYPLPQASSSYMHGGNPSGSVVMVSGLHQLKMNCS
Target-Kategorie: HNRNPLL
Application Verdünnung: WB: WB,1:500 - 1:2000