Cytokeratin 2e (KRT2) Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10375S
Artikelname: Cytokeratin 2e (KRT2) Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10375S
Hersteller Artikelnummer: CNA10375S
Alternativnummer: MBL-CNA10375S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human Cytokeratin 2e (KRT2) (NP_000414.2).
Konjugation: Unconjugated
Alternative Synonym: K2e, KRTE, CK-2e, KRT2A, KRT2E
Klonalität: Polyclonal
Molekulargewicht: 65kDa
NCBI: 3849
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MSCQISCKSRGRGGGGGGFRGFSSGSAVVSGGSRRSTSSFSCLSRHGGGGGGFGGGGFGSRSLVGLGGTKSISISVAGGGGGFGAAGGFGGRGGGFGGGSSFGGGSGFSGGGFGGGGFGGGRFGGFGGPGGVGGLGGPGGFGPGGYPGGIHEVSVNQSLLQPLNVKVDPEIQNVKAQEREQIKTLNNKFASFIDKVRFLEQQNQVLQTKWELLQQMNVGT
Target-Kategorie: KRT2
Application Verdünnung: WB: WB,1:500 - 1:2000