CHMP2A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10380S
Artikelname: CHMP2A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10380S
Hersteller Artikelnummer: CNA10380S
Alternativnummer: MBL-CNA10380S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-222 of human CHMP2A (NP_055268.1).
Konjugation: Unconjugated
Alternative Synonym: BC2, BC-2, VPS2, CHMP2, VPS2A
Klonalität: Polyclonal
Molekulargewicht: 25kDa
NCBI: 27243
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQIQKIMMEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELSNLPSTGGSLSVAAGGKKAEAAASALADADADLEERLKNLRRD
Target-Kategorie: CHMP2A
Application Verdünnung: WB: WB,1:500 - 1:2000