PPFIA1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10388S
Artikelname: PPFIA1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10388S
Hersteller Artikelnummer: CNA10388S
Alternativnummer: MBL-CNA10388S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 660-800 of human PPFIA1 (NP_003617.1).
Konjugation: Unconjugated
Alternative Synonym: LIP1, LIP.1, LIPRIN
Klonalität: Polyclonal
Molekulargewicht: 136kDa
NCBI: 8500
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: IESRVGSGSLDNLGRFRSMSSIPPYPASSLASSSPPGSGRSTPRRIPHSPAREVDRLGVMTLLPPSREEVRDDKTTIKCETSPPSSPRALRLDRLHKGALHTVSHEDIRDIRNSTGSQDGPVSNPSSSNSSQDSLHKAPKK
Target-Kategorie: PPFIA1
Application Verdünnung: WB: WB,1:500 - 1:2000