RAB3D Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10390S
Artikelname: RAB3D Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10390S
Hersteller Artikelnummer: CNA10390S
Alternativnummer: MBL-CNA10390S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-219 of human RAB3D (NP_004274.1).
Konjugation: Unconjugated
Alternative Synonym: GOV, D2-2, RAB16, RAD3D
Klonalität: Polyclonal
Molekulargewicht: 24kDa
NCBI: 9545
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MASAGDTQAGPRDAADQNFDYMFKLLLIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTVYRHDKRIKLQIWDTAGQERYRTITTAYYRGAMGFLLMYDIANQESFAAVQDWATQIKTYSWDNAQVILVGNKCDLEDERVVPAEDGRRLADDLGFEFFEASAKENINVKQVFERLVDVICEKMNESLEPSSSSGSNGKGPAVGDAPAPQPSSCSC
Target-Kategorie: RAB3D
Application Verdünnung: WB: WB,1:500 - 1:2000