REEP5 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10392S
Artikelname: REEP5 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10392S
Hersteller Artikelnummer: CNA10392S
Alternativnummer: MBL-CNA10392S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 120-189 of human REEP5 (NP_005660.4).
Konjugation: Unconjugated
Alternative Synonym: DP1, TB2, YOP1, POB16, Yip2e, D5S346, C5orf18
Klonalität: Polyclonal
Molekulargewicht: 21kDa
NCBI: 7905
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: FLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKST
Target-Kategorie: REEP5
Application Verdünnung: WB: WB,1:500 - 1:2000